PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0016s0217.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 177aa    MW: 20200 Da    PI: 4.6884
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0016s0217.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.54.1e-31113171159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYG+K+vk+s++pr+YY+C+ ++Cpvkk+ver++edp++v++tYeg H+h 
  Kalax.0016s0217.1.p 113 LDDGYKWRKYGKKMVKNSPNPRNYYKCSVEKCPVKKRVERDREDPRYVITTYEGVHTHM 171
                          59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-3399173IPR003657WRKY domain
SuperFamilySSF1182904.18E-28106173IPR003657WRKY domain
PROSITE profilePS5081130.446108173IPR003657WRKY domain
SMARTSM007743.1E-35113172IPR003657WRKY domain
PfamPF031062.8E-24114170IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MDGNSGDYQY QSMYNSFGYL DFGEASHANF GNSDFLPDYL LDDWFNQSDE PAVTGVELGQ  60
QDPVYQMSEV NGVEGNYYAQ NEETDTRESG SSTGRAQGKE KFAFKTKSEI DTLDDGYKWR  120
KYGKKMVKNS PNPRNYYKCS VEKCPVKKRV ERDREDPRYV ITTYEGVHTH MSPSGY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-25103174778Probable WRKY transcription factor 4
1wj2_A6e-25103174778Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445519.11e-49PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ52e-41WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A0A0KD403e-49A0A0A0KD40_CUCSA; Uncharacterized protein
STRINGVIT_04s0008g01470.t013e-48(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-42WRKY DNA-binding protein 50